Home | Top Views | Last Creations | Search | Random Mix | Comments | || YouTube Go on youtube.com

Check for low quality
| |
A Quadparison of Kyoobur9000 Logos that have been already Diamondified!
by Dr. Cow Remixes

This set has accumulated 2,279 points based on views and sharing
You like it? Red heart Make it famous: (4,557 views)


Youtube Thumbnail Kyoobur9000 Logo Enhanced with Diamond Standard
Kyoobur9000 Logo Enhanced with Diamond Standard
by Kyoobur9000
0:37 - 26,512 views

Honestly... I can't believe it took me this long to get the bright idea to do this.
Youtube Thumbnail Kyoobur9000 Logo Final Version as of 9.26.12 (Description for details)
Kyoobur9000 Logo Final Version as of 9.26.12 (Description for details)
by Kyoobur9000
0:38 - 11,824 views

This logo was created almost a week ago, but it was finalized in this video. This logo will be called the MD9K, short for "Modern-Day Kyoobur9000". According to a sequence brought to my attention by @logoking1, this video may also be called "The 9K Kyoob IV" as it is the fourth widely-used Kyoob on my channel.

PowerPoint was needed to construct the shapes and cut them up, and Sony Vegas was needed for most of the motion. I used Garageband to make the original audio, and edited it at home with Audacity. It is one of my most intricate logos to date.
Youtube Thumbnail Kyoobur9000 Overlapping 9K Animated Logo
Kyoobur9000 Overlapping 9K Animated Logo
by Kyoobur9000
0:37 - 24,484 views

Aaaaaaaaaaand it's my new logo.

Microsoft - Sony - Audacity - Apple
Youtube Thumbnail Kyoobur9000 Modern Kyoob Logo Version 2
Kyoobur9000 Modern Kyoob Logo Version 2
by Kyoobur9000
0:39 - 6,925 views

Now the kyoob merges instead of rises. I have another version already planned, and it's gonna blow your mind.
Other Mashups
Comment (0)
Do another Mashup
See another Mashup !
evan AIRPLANE REMIX xxx (better starting position) fghjkltrifdakswadaaiweqdimitriaaaf agdfjhgajfkhgfdkjhgfdag
JIBUN WOOOOOOOOOOOOOOOOOOOOOOOOO Derpdodeeprodowpeoksk 64 created AAO videos playing at once.
Another Sparta remix Quadparison remake i deeply medidate inspirational song Walt Wants Jesse's Girl
Up to Faster super duper duper duper parison to Bing (VERY LOUD WARNING) LucyPrecure&PurpleCrewPals and her flip buddies crying (YOU DESERVE THIS FOR USING KC SFX) Let's Remake FTW 01 --- Sparta Extended Remixes Side-By-Side 434